PUF60 (NM_014281) Human Recombinant Protein
CAT#: TP303454
Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 20 µg
View other "PUF60" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203454 protein sequence
Red=Cloning site Green=Tags(s) MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKS IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNR IYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYL RVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTL PQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ EHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEE DAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055096 |
| Locus ID | 22827 |
| UniProt ID | Q9UHX1 |
| Refseq Size | 1897 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 1626 |
| Synonyms | FIR; RoBPI; SIAHBP1; VRJS |
| Summary | This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012] |
| Protein Pathways | Spliceosome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The prevalence and clinical significance of anti-PUF60 antibodies in patients with idiopathic inflammatory myopathy.
,null,
Clinical rheumatology
,PubMed ID 29541951
[PUF60]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409189 | PUF60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415385 | PUF60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409189 | Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1 |
CNY 4840.00 |
|
| LY415385 | Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2 |
CNY 3080.00 |
|
| PH303454 | PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096) |
CNY 19520.00 |
|
| PH323492 | PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965) |
CNY 19520.00 |
|
| TP323492 | Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 20 µg |
CNY 2900.00 |
