POLR1C (NM_203290) Human Recombinant Protein
CAT#: TP303486
Recombinant protein of human polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1, 20 µg
View other "POLR1C" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203486 protein sequence
Red=Cloning site Green=Tags(s) MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA AIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQF RLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDL LMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRL DTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_976035 |
Locus ID | 9533 |
UniProt ID | O15160 |
Refseq Size | 1353 |
Cytogenetics | 6p21.1 |
Refseq ORF | 1038 |
Synonyms | AC40; HLD11; RPA5; RPA39; RPA40; RPAC1; RPC40; TCS3 |
Summary | The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404374 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417693 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429225 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404374 | Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1 |
CNY 3080.00 |
|
LY417693 | Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 2 |
CNY 3080.00 |
|
PH303486 | POLR1C MS Standard C13 and N15-labeled recombinant protein (NP_976035) |
CNY 19520.00 |