FAM55C (NXPE3) (NM_145037) Human Recombinant Protein
CAT#: TP303542
Recombinant protein of human family with sequence similarity 55, member C (FAM55C), transcript variant 2, 20 µg
View other "FAM55C" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203542 protein sequence
Red=Cloning site Green=Tags(s) MWTNFFKLRLFCCLLAVLMVVVLVINVTQVEYLDHETVSATFIDSSGQFVSSQVTGISRNPYCGYDQQTL SSQERMEEDSLLAALHRQVPDVGPVPFVKSTDPSSSYFVILNSAAFFKVGSQLEVLVHVQDFQRKPKKYG GDYLQARIHSLKLQAGAVGRVVDYQNGFYKVFFTLLWPGKVKVSVSLVHPSEGIRVLQRLQEDKPDRVYF KSLFRSGRISETTECNVCLPGNLPLCNFTDLYTGEPWFCFKPKKLPCSSRITHFKGGYLKGLLTAAESAF FQSGVNIKMPVNSSGPDWVTVIPRRIKETNSLELSQGSGTFPSGYYYKDQWRPRKFKMRQFNDPDNITEC LQRKVVHLFGDSTIRQWFEYLTTFVPDLVEFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRFTTVFSN ELHYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVRLLDRSPKTVVVIRTANAQELG PEVSLFNSDWYNFQLDTILRRMFSGVGVYLVDAWEMTLAHYLPHKLHPDEVIVKNQLDMFLSFVCPLET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659474 |
Locus ID | 91775 |
UniProt ID | Q969Y0 |
Refseq Size | 8610 |
Cytogenetics | 3q12.3 |
Refseq ORF | 1677 |
Synonyms | FAM55C; MST115; MSTP115 |
Summary | This gene encodes a member of the neurexophilin family of neuropeptide-like glycoproteins. The encoded protein contains a variable N-terminal domain, a highly conserved neurexophilin and PC-esterase (NXPE) central domain, a short linker region, and a cysteine-rich C-terminal domain. This protein binds alpha neurexins, a group of presynaptic transmembrane receptors that promote adhesion between dendrites and axons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2017] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403417 | NXPE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427447 | NXPE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403417 | Transient overexpression lysate of family with sequence similarity 55, member C (FAM55C), transcript variant 2 |
CNY 3080.00 |
|
LY427447 | Transient overexpression lysate of family with sequence similarity 55, member C (FAM55C), transcript variant 1 |
CNY 3080.00 |
|
PH303542 | FAM55C MS Standard C13 and N15-labeled recombinant protein (NP_659474) |
CNY 19520.00 |