JUNB (NM_002229) Human Recombinant Protein
CAT#: TP303595
Recombinant protein of human jun B proto-oncogene (JUNB), 20 µg
View other "JUNB" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203595 protein sequence
Red=Cloning site Green=Tags(s) MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFS GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV KALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPT TTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme substrate (PMID: 29804834) |
Reference Data | |
RefSeq | NP_002220 |
Locus ID | 3726 |
UniProt ID | P17275 |
Refseq Size | 1832 |
Cytogenetics | 19p13.13 |
Refseq ORF | 1041 |
Synonyms | AP-1 |
Summary | Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[CG]TCA-3'.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Activating transcription factor 3 inhibits endometrial carcinoma aggressiveness via JunB suppression
,Wang, F;Li, J;Wang, H;Zhang, F;Gao, J;,
Int. J. Oncol.
,PubMed ID 32582999
[JUNB]
|
Time-Resolved Analysis Reveals Rapid Dynamics and Broad Scope of the CBP/p300 Acetylome
,Weinert, BT;Narita, T;Satpathy, S;Srinivasan, B;Hansen, BK;Schölz, C;Hamilton, WB;Zucconi, BE;Wang, WW;Liu, WR;Brickman, JM;Kesicki, EA;Lai, A;Bromberg, KD;Cole, PA;Choudhary, C;,
Cell
,PubMed ID 29804834
[JUNB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |