CCDC28B (NM_024296) Human Recombinant Protein
CAT#: TP303631
Recombinant protein of human coiled-coil domain containing 28B (CCDC28B), 20 µg
View other "CCDC28B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203631 protein sequence
Red=Cloning site Green=Tags(s) MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGS GSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCG EEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_077272 |
| Locus ID | 79140 |
| UniProt ID | Q9BUN5 |
| Refseq Size | 1110 |
| Cytogenetics | 1p35.2 |
| Refseq ORF | 600 |
| Summary | The product of this gene localizes to centrosomes and basal bodies. The protein colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS) and participates in the regulation of cilia development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411317 | CCDC28B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411317 | Transient overexpression lysate of coiled-coil domain containing 28B (CCDC28B) |
CNY 3080.00 |
|
| PH303631 | CCDC28B MS Standard C13 and N15-labeled recombinant protein (NP_077272) |
CNY 19520.00 |
其它CCDC28B产品
