EWSR1 (NM_005243) Human Recombinant Protein
CAT#: TP303709
Recombinant protein of human Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant EWS, 20 µg
View other "EWSR1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 3 publications. |
CNY 1999.00
CNY 3490.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203709 protein sequence
Red=Cloning site Green=Tags(s) MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY GQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ DGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQ QNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQ ESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPP VDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPP TAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRG GDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGG DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGG RRGGRGGPGKMDKGEHRQERRDRPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Transmission electron microscopy (PMID: 26286827) In vitro kinase assay inhibitor (PMID: 29513652) |
Reference Data | |
RefSeq | NP_005234 |
Locus ID | 2130 |
UniProt ID | Q01844 |
Refseq Size | 2679 |
Cytogenetics | 22q12.2 |
Refseq ORF | 1965 |
Synonyms | bK984G1.4; EWS; EWS-FLI1 |
Summary | This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Cohesin SA1 and SA2 are RNA binding proteins that localize to RNA containing regions on DNA
,Pan, H;Jin, M;Ghadiyaram, A;Kaur, P;Miller, HE;Ta, HM;Liu, M;Fan, Y;Mahn, C;Gorthi, A;You, C;Piehler, J;Riehn, R;Bishop, AJR;Tao, YJ;Wang, H;,
Nucleic Acids Res.
,PubMed ID 32352519
[EWSR1]
|
EWS-FLI1 increases transcription to cause R-loops and block BRCA1 repair in Ewing sarcoma
,Gorthi, A;Romero, JC;Loranc, E;Cao, L;Lawrence, LA;Goodale, E;Iniguez, AB;Bernard, X;Masamsetti, VP;Roston, S;Lawlor, ER;Toretsky, JA;Stegmaier, K;Lessnick, SL;Chen, Y;Bishop, AJR;,
Nature
,PubMed ID 29513652
[EWSR1]
|
Liquid demixing of intrinsically disordered proteins is seeded by poly(ADP-ribose)
,Altmeyer, M;Neelsen, KJ;Teloni, F;Pozdnyakova, I;Pellegrino, S;Grøfte, M;Rask, MB;Streicher, W;Jungmichel, S;Nielsen, ML;Lukas, J;,
Nat Commun
,PubMed ID 26286827
[EWSR1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401610 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431514 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432342 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401610 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2 |
CNY 3080.00 |
|
LY431514 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 4 |
CNY 3080.00 |
|
LY432342 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 1 |
CNY 3080.00 |
|
PH303709 | EWSR1 MS Standard C13 and N15-labeled recombinant protein (NP_005234) |
CNY 19520.00 |