Alanine Transaminase (GPT) (NM_005309) Human Recombinant Protein
CAT#: TP303756
Recombinant protein of human glutamic-pyruvate transaminase (alanine aminotransferase) (GPT), 20 µg
View other "Alanine Transaminase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203756 protein sequence
Red=Cloning site Green=Tags(s) MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGD AQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYI ERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDE ERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVY AAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCP PVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAK FTLEYS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005300 |
| Locus ID | 2875 |
| UniProt ID | P24298 |
| Refseq Size | 1896 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 1488 |
| Synonyms | AAT1; ALT1; GPT1 |
| Summary | This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.[provided by RefSeq, Nov 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity
,Hu, Z;Lausted, C;Yoo, H;Yan, X;Brightman, A;Chen, J;Wang, W;Bu, X;Hood, L;,
Theranostics, Jan 2014.
,PubMed ID 24465277
[GPT]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417391 | GPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417391 | Transient overexpression lysate of glutamic-pyruvate transaminase (alanine aminotransferase) (GPT) |
CNY 3080.00 |
|
| PH303756 | GPT MS Standard C13 and N15-labeled recombinant protein (NP_005300) |
CNY 19520.00 |
其它Alanine Transaminase产品
