ZFAND2B (NM_138802) Human Recombinant Protein
CAT#: TP303822
Recombinant protein of human zinc finger, AN1-type domain 2B (ZFAND2B), 20 µg
View other "ZFAND2B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203822 protein sequence
Red=Cloning site Green=Tags(s) MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGE PPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHP TSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSL AETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620157 |
Locus ID | 130617 |
UniProt ID | Q8WV99 |
Refseq Size | 1323 |
Cytogenetics | 2q35 |
Refseq ORF | 771 |
Synonyms | AIRAPL |
Summary | This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408488 | ZFAND2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408488 | Transient overexpression lysate of zinc finger, AN1-type domain 2B (ZFAND2B) |
CNY 3080.00 |
|
PH303822 | ZFAND2B MS Standard C13 and N15-labeled recombinant protein (NP_620157) |
CNY 19520.00 |
其它ZFAND2B产品