Aldolase (ALDOA) (NM_184041) Human Recombinant Protein
CAT#: TP303900
Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2, 20 µg
View other "Aldolase" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203900 protein sequence
Red=Cloning site Green=Tags(s) MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_908930 |
Locus ID | 226 |
UniProt ID | P04075 |
Refseq Size | 1597 |
Cytogenetics | 16p11.2 |
Refseq ORF | 1092 |
Synonyms | ALDA; GSD12; HEL-S-87p |
Summary | This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Sep 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400006 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405206 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405207 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426825 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400006 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 |
CNY 3080.00 |
|
LY405206 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2 |
CNY 3080.00 |
|
LY405207 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3 |
CNY 3080.00 |
|
LY426825 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4 |
CNY 3080.00 |
|
PH302576 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_000025) |
CNY 19520.00 |
|
PH303900 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908930) |
CNY 19520.00 |
|
PH303908 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908932) |
CNY 19520.00 |
|
PH325547 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_001121089) |
CNY 19520.00 |
|
TP302576 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP303908 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP325547 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP720179 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 |
CNY 1800.00 |
其它Aldolase产品