RAB3A (NM_002866) Human Recombinant Protein
CAT#: TP303973
Recombinant protein of human RAB3A, member RAS oncogene family (RAB3A), 20 µg
View other "RAB3A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203973 protein sequence
Red=Cloning site Green=Tags(s) MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ QVPPHQDCAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002857 |
Locus ID | 5864 |
UniProt ID | P20336 |
Refseq Size | 1528 |
Cytogenetics | 19p13.11 |
Refseq ORF | 660 |
Summary | Small GTP-binding protein that plays a central role in regulated exocytosis and secretion. Controls the recruitment, tethering and docking of secretory vesicles to the plasma membrane (By similarity). Upon stimulation, switches to its active GTP-bound form, cycles to vesicles and recruits effectors such as RIMS1, RIMS2, Rabphilin-3A/RPH3A, RPH3AL or SYTL4 to help the docking of vesicules onto the plasma membrane (By similarity). Upon GTP hydrolysis by GTPase-activating protein, dissociates from the vesicle membrane allowing the exocytosis to proceed (By similarity). Stimulates insulin secretion through interaction with RIMS2 or RPH3AL effectors in pancreatic beta cells (By similarity). Regulates calcium-dependent lysosome exocytosis and plasma membrane repair (PMR) via the interaction with 2 effectors, SYTL4 and myosin-9/MYH9 (PubMed:27325790). Acts as a positive regulator of acrosome content secretion in sperm cells by interacting with RIMS1 (PubMed:22248876, PubMed:30599141). Plays also a role in the regulation of dopamine release by interacting with synaptotagmin I/SYT (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Novel antibodies reveal presynaptic localization of C9orf72 protein and reduced protein levels in C9orf72 mutation carriers
,Frick, P;Sellier, C;Mackenzie, IRA;Cheng, CY;Tahraoui-Bories, J;Martinat, C;Pasterkamp, RJ;Prudlo, J;Edbauer, D;Oulad-Abdelghani, M;Feederle, R;Charlet-Berguerand, N;Neumann, M;,
Acta Neuropathol Commun
,PubMed ID 30075745
[RAB3A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419059 | RAB3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419059 | Transient overexpression lysate of RAB3A, member RAS oncogene family (RAB3A) |
CNY 3080.00 |
|
PH303973 | RAB3A MS Standard C13 and N15-labeled recombinant protein (NP_002857) |
CNY 19520.00 |