MED8 (NM_201542) Human Recombinant Protein
CAT#: TP304026L
Recombinant protein of human mediator complex subunit 8 (MED8), transcript variant 1, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
货期*
4周
规格
推荐一起购买 (3)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204026 protein sequence
Red=Cloning site Green=Tags(s) MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEER ESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAP SQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_963836 |
| Locus ID | 112950 |
| UniProt ID | Q96G25 |
| Refseq Size | 1989 |
| Cytogenetics | 1p34.2 |
| Refseq ORF | 537 |
| Synonyms | ARC32 |
| Summary | This gene encodes a protein component of the mediator complex, which aids in transcriptional activation through interaction with RNA polymerase II and gene-specific transcription factors. The encoded protein may also function in ubiquitin ligation and protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...


