Ribonuclease H2, subunit A (RNASEH2A) (NM_006397) Human Recombinant Protein
CAT#: TP304032
Recombinant protein of human ribonuclease H2, subunit A (RNASEH2A), 20 µg
View other "Ribonuclease H2, subunit A" proteins (4)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC204032 protein sequence 
Red=Cloning site Green=Tags(s) MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKT LLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFV DTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGY PNDPKTKAWLKEHVEPVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQAR PRSSHRYFLERGLESATSL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 33.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_006388 | 
| Locus ID | 10535 | 
| UniProt ID | O75792 | 
| Refseq Size | 1148 | 
| Cytogenetics | 19p13.13 | 
| Refseq ORF | 897 | 
| Synonyms | AGS4; JUNB; RNASEHI; RNHIA; RNHL; THSD8 | 
| Summary | The protein encoded by this gene is a component of the heterotrimeric type II ribonuclease H enzyme (RNAseH2). RNAseH2 is the major source of ribonuclease H activity in mammalian cells and endonucleolytically cleaves ribonucleotides. It is predicted to remove Okazaki fragment RNA primers during lagging strand DNA synthesis and to excise single ribonucleotides from DNA-DNA duplexes. Mutations in this gene cause Aicardi-Goutieres Syndrome (AGS), a an autosomal recessive neurological disorder characterized by progressive microcephaly and psychomotor retardation, intracranial calcifications, elevated levels of interferon-alpha and white blood cells in the cerebrospinal fluid.[provided by RefSeq, Aug 2009] | 
| Protein Pathways | DNA replication | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Ribonuclease H2 mutations induce a  cGAS/ STING‐dependent innate immune response
                                                ,null,
                                                The EMBO Journal
                                                ,PubMed ID 26903602
                                                [RNASEH2A]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC416666 | RNASEH2A HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY416666 | Transient overexpression lysate of ribonuclease H2, subunit A (RNASEH2A) | 
                                                     CNY 3080.00  | 
                                            |
| PH304032 | RNASEH2A MS Standard C13 and N15-labeled recombinant protein (NP_006388) | 
                                                     CNY 19520.00  | 
                                            |
| TP762504 | Purified recombinant protein of Human ribonuclease H2, subunit A (RNASEH2A), full length, with N-terminal His tag, expressed in E.coli, 50ug | 
                                                     CNY 2150.00  | 
                                            
其它Ribonuclease H2, subunit A产品
