COTL1 (NM_021149) Human Recombinant Protein
CAT#: TP304055
Recombinant protein of human coactosin-like 1 (Dictyostelium) (COTL1), 20 µg
View other "COTL1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204055 protein sequence
Red=Cloning site Green=Tags(s) MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM SKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQ TE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066972 |
Locus ID | 23406 |
UniProt ID | Q14019 |
Refseq Size | 1893 |
Cytogenetics | 16q24.1 |
Refseq ORF | 426 |
Synonyms | CLP |
Summary | This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402845 | COTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402845 | Transient overexpression lysate of coactosin-like 1 (Dictyostelium) (COTL1) |
CNY 3080.00 |
|
PH304055 | COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972) |
CNY 19520.00 |