STK38 (NM_007271) Human Recombinant Protein
CAT#: TP304133
Recombinant protein of human serine/threonine kinase 38 (STK38), 20 µg
View other "STK38" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204133 protein sequence
Red=Cloning site Green=Tags(s) MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 54 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vitro ubiquitination assay (regulator) (PMID: 25981615) Pull-down assay (PMID: 28219902) |
Reference Data | |
RefSeq | NP_009202 |
Locus ID | 11329 |
UniProt ID | Q15208 |
Refseq Size | 3593 |
Cytogenetics | 6p21.31 |
Refseq ORF | 1395 |
Synonyms | NDR; NDR1 |
Summary | This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015] |
Protein Families | Druggable Genome, Protein Kinase |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
NDR1 protein kinase promotes IL-17- and TNF-α-mediated inflammation by competitively binding TRAF3
,Ma, C;Lin, W;Liu, Z;Tang, W;Gautam, R;Li, H;Qian, Y;Huang, H;Wang, X;,
EMBO Rep
,PubMed ID 28219902
[STK38]
|
Stk38 protein kinase preferentially inhibits TLR9-activated inflammatory responses by promoting MEKK2 ubiquitination in macrophages
,Wen, M;Ma, X;Cheng, H;Jiang, W;Xu, X;Zhang, Y;Zhang, Y;Guo, Z;Yu, Y;Xu, H;Qian, C;Cao, X;An, H;,
Nat Commun
,PubMed ID 25981615
[STK38]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402123 | STK38 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402123 | Transient overexpression lysate of serine/threonine kinase 38 (STK38) |
CNY 3080.00 |
|
PH304133 | STK38 MS Standard C13 and N15-labeled recombinant protein (NP_009202) |
CNY 19520.00 |