ID4 (NM_001546) Human Recombinant Protein
CAT#: TP304170M
Recombinant protein of human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204170 representing NM_001546
Red=Cloning site Green=Tags(s) MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL TALNTDPAGAVNKQGDSILCR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001537 |
| Locus ID | 3400 |
| UniProt ID | P47928 |
| Refseq Size | 2389 |
| Cytogenetics | 6p22.3 |
| Refseq ORF | 483 |
| Synonyms | bHLHb27; IDB4 |
| Summary | This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017] |
| Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
| Protein Pathways | TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
