MALT1 (NM_173844) Human Recombinant Protein
CAT#: TP304322
Purified recombinant protein of Homo sapiens mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 2, 20 µg
View other "MALT1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204322 representing NM_173844
Red=Cloning site Green=Tags(s) MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLS CLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLA GQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCD IPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYV DLEHQGTYWCHVYNDRDSQDSKKVEIIIDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKA PLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAP NPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEI QHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSA ESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDI DPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPL IAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSR TPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 90.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_776216 |
Locus ID | 10892 |
UniProt ID | Q9UDY8 |
Refseq Size | 4996 |
Cytogenetics | 18q21.32 |
Refseq ORF | 2439 |
Synonyms | IMD12; MLT; MLT1; PCASP1 |
Summary | This gene encodes a caspase-like protease that plays a role in BCL10-induced activation of NF-kappaB. The protein is a component of the CARMA1-BCL10-MALT1 (CBM) signalosome that triggers NF-kappaB signaling and lymphoctye activation following antigen-receptor stimulation. Mutations in this gene result in immunodeficiency 12 (IMD12). This gene has been found to be recurrently rearranged in chromosomal translocations with other genes in mucosa-associated lymphoid tissue lymphomas, including a t(11;18)(q21;q21) translocation with the baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) locus [BIRC3(API2)-MALT1], and a t(14;18)(q32;q21) translocation with the immunoglobulin heavy chain locus (IGH-MALT1). Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2018] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | B cell receptor signaling pathway, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402030 | MALT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC406281 | MALT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402030 | Transient overexpression lysate of mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 1 |
CNY 4840.00 |
|
LY406281 | Transient overexpression lysate of mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 2 |
CNY 3080.00 |
|
PH304322 | MALT1 MS Standard C13 and N15-labeled recombinant protein (NP_776216) |
CNY 14250.00 |
|
PH314639 | MALT1 MS Standard C13 and N15-labeled recombinant protein (NP_006776) |
CNY 19520.00 |
|
TP314639 | Recombinant protein of human mucosa associated lymphoid tissue lymphoma translocation gene 1 (MALT1), transcript variant 1, 20 µg |
CNY 2900.00 |