TXNL6 (NXNL1) (NM_138454) Human Recombinant Protein
CAT#: TP304346
Recombinant protein of human nucleoredoxin-like 1 (NXNL1), 20 µg
View other "TXNL6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204346 protein sequence
Red=Cloning site Green=Tags(s) MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRA AQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADE IQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGG LF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_612463 |
| Locus ID | 115861 |
| UniProt ID | Q96CM4 |
| Refseq Size | 948 |
| Cytogenetics | 19p13.11 |
| Refseq ORF | 636 |
| Synonyms | RDCVF; TXNL6 |
| Summary | Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
TXNL6 Is a Novel Oxidative Stress-Induced Reducing System for Methionine Sulfoxide Reductase A Repair of ?-Crystallin and Cytochrome C in the Eye Lens
,null,
PLoS ONE
,PubMed ID 21079812
[NXNL1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
