Syntaxin 16 (STX16) (NM_003763) Human Recombinant Protein
CAT＃: TP304347
Recombinant protein of human syntaxin 16 (STX16), transcript variant 2, 20 µg
View other "Syntaxin 16" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204347 protein sequence
Red=Cloning site Green=Tags(s) MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGR IKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNV VASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTL MVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRK MLVILILFVIIIVLIVVLVGVKSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003754 |
| Locus ID | 8675 |
| UniProt ID | O14662 |
| Refseq Size | 4915 |
| Cytogenetics | 20q13.32 |
| Refseq ORF | 912 |
| Synonyms | SYN16 |
| Summary | This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418449 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424352 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425029 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427489 | STX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418449 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 2 |
CNY 3080.00 |
|
| LY424352 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 1 |
CNY 3080.00 |
|
| LY425029 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 1 |
CNY 3080.00 |
|
| LY427489 | Transient overexpression lysate of syntaxin 16 (STX16), transcript variant 4 |
CNY 3080.00 |
|
| PH304347 | STX16 MS Standard C13 and N15-labeled recombinant protein (NP_003754) |
CNY 19520.00 |
其它Syntaxin 16产品
