SGK3 (NM_013257) Human Recombinant Protein
CAT#: TP304416
Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1, 20 µg
View other "SGK3" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204416 protein sequence
Red=Cloning site Green=Tags(s) MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMAL KIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKL HSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAE RNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSI KIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAV LYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP SEDLFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037389 |
Locus ID | 23678 |
UniProt ID | Q96BR1, A0A024R807, Q53EW6, Q5H9Q5 |
Refseq Size | 4206 |
Cytogenetics | 8q13.1 |
Refseq ORF | 1488 |
Synonyms | CISK; SGK2; SGKL |
Summary | This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406888 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC415716 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422403 | SGK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY406888 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 2 |
CNY 4,840.00 |
|
LY415716 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 1 |
CNY 3,080.00 |
|
LY422403 | Transient overexpression lysate of serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3 |
CNY 4,840.00 |
|
PH304416 | SGK3 MS Standard C13 and N15-labeled recombinant protein (NP_037389) |
CNY 19,520.00 |
|
TP760266 | Recombinant protein of human serum/glucocorticoid regulated kinase family, member 3 (SGK3), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |