HDHD1A (PUDP) (NM_012080) Human Recombinant Protein
CAT#: TP304419M
Recombinant protein of human haloacid dehalogenase-like hydrolase domain containing 1A (HDHD1A), transcript variant 2, 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204419 protein sequence
Red=Cloning site Green=Tags(s) MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDI FLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGL PSYE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036212 |
| Locus ID | 8226 |
| UniProt ID | Q08623 |
| Refseq Size | 2155 |
| Cytogenetics | Xp22.31 |
| Refseq ORF | 642 |
| Synonyms | DXF68S1E; FAM16AX; GS1; HDHD1; HDHD1A |
| Summary | This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2010] |
Documents
| FAQs |
| SDS |
