SEH1L (NM_031216) Human Recombinant Protein
CAT#: TP304536
Recombinant protein of human SEH1-like (S. cerevisiae) (SEH1L), transcript variant 2, 20 µg
View other "SEH1L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204536 protein sequence
Red=Cloning site Green=Tags(s) MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEF GQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVR IYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYA KAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQ VWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSL NGSSAGRKHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112493 |
Locus ID | 81929 |
UniProt ID | Q96EE3 |
Refseq Size | 3513 |
Cytogenetics | 18p11.21 |
Refseq ORF | 1080 |
Synonyms | SEC13L; Seh1; SEH1A; SEH1B |
Summary | The protein encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including this protein, specifically localize to kinetochores in mitosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403101 | SEH1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403101 | Transient overexpression lysate of SEH1-like (S. cerevisiae) (SEH1L), transcript variant 2 |
CNY 3080.00 |
|
PH304536 | SEH1L MS Standard C13 and N15-labeled recombinant protein (NP_112493) |
CNY 19520.00 |