RAB3IL1 (NM_013401) Human Recombinant Protein
CAT#: TP304592
Recombinant protein of human RAB3A interacting protein (rabin3)-like 1 (RAB3IL1), 20 µg
View other "RAB3IL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204592 protein sequence
Red=Cloning site Green=Tags(s) MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLDVLRLRSSSME IREKGSEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQL KEARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLCPAVCPAAGHT LTPDREGKEVDTILFAEFQAWRESPTLDKTCPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEP VASQTLPTVKVAEVDCSSTNTCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQG LVRQDAEPMFWEIMRLRKEMSLAKLGFFPQEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_037533 |
| Locus ID | 5866 |
| UniProt ID | Q8TBN0 |
| Refseq Size | 2392 |
| Cytogenetics | 11q12.2-q12.3 |
| Refseq ORF | 1146 |
| Synonyms | GRAB |
| Summary | This gene encodes a guanine nucleotide exchange factor for the ras-related protein Rab3A. The encoded protein binds Rab3a and the inositol hexakisphosphate kinase InsP6K1. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Nov 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415621 | RAB3IL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415621 | Transient overexpression lysate of RAB3A interacting protein (rabin3)-like 1 (RAB3IL1) |
CNY 3080.00 |
|
| PH304592 | RAB3IL1 MS Standard C13 and N15-labeled recombinant protein (NP_037533) |
CNY 19520.00 |
其它RAB3IL1产品
