ANKRD49 (NM_017704) Human Recombinant Protein
CAT#: TP304657
Recombinant protein of human ankyrin repeat domain 49 (ANKRD49), 20 µg
View other "ANKRD49" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204657 protein sequence
Red=Cloning site Green=Tags(s) MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKM EKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVD GWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEE TAFDIARRTSIYHYLFEIVEGCTNSSPQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060174 |
| Locus ID | 54851 |
| UniProt ID | Q8WVL7 |
| Refseq Size | 1924 |
| Cytogenetics | 11q21 |
| Refseq ORF | 717 |
| Synonyms | FGIF; GBIF |
| Summary | Induces HBG1 expression (PubMed:16131492, PubMed:11162141). May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413612 | ANKRD49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413612 | Transient overexpression lysate of ankyrin repeat domain 49 (ANKRD49) |
CNY 3080.00 |
|
| PH304657 | ANKRD49 MS Standard C13 and N15-labeled recombinant protein (NP_060174) |
CNY 19520.00 |
其它ANKRD49产品
