Fibulin 5 (FBLN5) (NM_006329) Human Recombinant Protein
CAT#: TP304683
Recombinant protein of human fibulin 5 (FBLN5), 20 µg
View other "Fibulin 5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204683 protein sequence
Red=Cloning site Green=Tags(s) MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCVNQNGGYLCIP RTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNP TQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGRSCQDVNE CATENPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILL DDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILY RDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDL EMITVNTVINFRGSSVIRLRIYVSQYPF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006320 |
| Locus ID | 10516 |
| UniProt ID | Q9UBX5 |
| Refseq Size | 2637 |
| Cytogenetics | 14q32.12 |
| Refseq ORF | 1344 |
| Synonyms | ADCL2; ARCL1A; ARMD3; DANCE; EVEC; FIBL-5; HNARMD; UP50 |
| Summary | The protein encoded by this gene is a secreted, extracellular matrix protein containing an Arg-Gly-Asp (RGD) motif and calcium-binding EGF-like domains. It promotes adhesion of endothelial cells through interaction of integrins and the RGD motif. It is prominently expressed in developing arteries but less so in adult vessels. However, its expression is reinduced in balloon-injured vessels and atherosclerotic lesions, notably in intimal vascular smooth muscle cells and endothelial cells. Therefore, the protein encoded by this gene may play a role in vascular development and remodeling. Defects in this gene are a cause of autosomal dominant cutis laxa, autosomal recessive cutis laxa type I (CL type I), and age-related macular degeneration type 3 (ARMD3). [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
| Shipping | Dry Ice |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
LTBP-2 competes with tropoelastin for binding to fibulin-5 and heparin, and is a negative modulator of elastinogenesis
,Sideek, MA;Menz, C;Parsi, MK;Gibson, MA;,
Matrix Biol. 2013 Oct 19. pii: S0945-053X(13)00136-4. doi: 10.1016
,PubMed ID 24148803
[FBLN5]
|
|
KSHV Regulation of Fibulin-2 in Kaposi's Sarcoma
,null,
The American Journal of Pathology
,PubMed ID 21741351
[FBLN5]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
其它Fibulin 5产品
