Eotaxin (CCL11) (NM_002986) Human Recombinant Protein
CAT#: TP304726
Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
View other "Eotaxin" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204726 protein sequence
Red=Cloning site Green=Tags(s) MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAK DICADPKKKWVQDSMKYLDQKSPTPKP myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 10.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002977 |
Locus ID | 6356 |
UniProt ID | P51671, Q6I9T4 |
Refseq Size | 925 |
Cytogenetics | 17q12 |
Refseq ORF | 291 |
Synonyms | SCYA11 |
Summary | This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity for eosinophils, but not mononuclear cells or neutrophils. This eosinophil-specific chemokine is thought to be involved in eosinophilic inflammatory diseases such as atopic dermatitis, allergic rhinitis, asthma and parasitic infections. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Asthma, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401045 | CCL11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401045 | Transient overexpression lysate of chemokine (C-C motif) ligand 11 (CCL11) |
CNY 3080.00 |
|
TP720904 | Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11) |
CNY 1800.00 |
|
TP723801 | Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11 / Eotaxin) |
CNY 3820.00 |
|
TP723802 | Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11 / Eotaxin) |
CNY 3820.00 |
|
TP762003 | Purified recombinant protein of Human chemokine (C-C motif) ligand 11 (CCL11),Gly24-Pro97, with N-terminal His-Trx tag, expressed in E. coli, 50ug |
CNY 2050.00 |
其它Eotaxin产品