C4BPA (NM_000715) Human Recombinant Protein
CAT#: TP304738
Recombinant protein of human complement component 4 binding protein, alpha (C4BPA), 20 µg
View other "C4BPA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204738 protein sequence
Red=Cloning site Green=Tags(s) MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETR FKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSC SEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLL GHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIH CDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQK NLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELV NGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLP NPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 61.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000706 |
| Locus ID | 722 |
| UniProt ID | P04003 |
| Refseq Size | 2256 |
| Cytogenetics | 1q32.2 |
| Refseq ORF | 1791 |
| Synonyms | C4BP; PRP |
| Summary | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Complement and coagulation cascades |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Fucosylated C4b‑binding protein α‑chain, a novel serum biomarker that predicts lymph node metastasis in pancreatic ductal adenocarcinoma
,Sogawa, K;Yamanaka, S;Takano, S;Sasaki, K;Miyahara, Y;Furukawa, K;Takayashiki, T;Kuboki, S;Takizawa, H;Nomura, F;Ohtsuka, M;,
Oncology Letters
,PubMed ID 33552248
[C4BPA]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424544 | C4BPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424544 | Transient overexpression lysate of complement component 4 binding protein, alpha (C4BPA) |
CNY 3080.00 |
|
| PH304738 | C4BPA MS Standard C13 and N15-labeled recombinant protein (NP_000706) |
CNY 14250.00 |
