Claudin 3 (CLDN3) (NM_001306) Human Recombinant Protein

CAT#: TP304882L

Purified recombinant protein of Human claudin 3 (CLDN3), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 1mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 36000.00


货期*
4周

规格
    • 1 mg

Product images

推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


CLDN3 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
    • 100 ul

CNY 1999.00
CNY 2700.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204882 protein sequence
Red=Cloning site Green=Tags(s)

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLL
ALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAALLTLVPVSWSAN
TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASL
GTGYDRKDYV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.3 kDa
Concentration >50 ug/mL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
Storage Store at -80°C after receiving vials.
Stability Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001297
Locus ID 1365
UniProt ID O15551, Q75L79
Refseq Size 1318
Cytogenetics 7q11.23
Refseq ORF 660
Synonyms C7orf1; CPE-R2; CPETR2; HRVP1; RVP1
Summary Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...