MIR16 (GDE1) (NM_016641) Human Recombinant Protein
CAT#: TP304923
Recombinant protein of human glycerophosphodiester phosphodiesterase 1 (GDE1), 20 µg
View other "MIR16" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204923 protein sequence
Red=Cloning site Green=Tags(s) MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAH RGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPA ANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQLYNNSVVCSFLPEVI YKMRQTDRDVITALTHRPWSLSHTGDGKPRYDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDF VSPAYLKKWSAKGIQVVGWTVNTFDEKSYYESHLGSSYITDSMVEDCEPHF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057725 |
Locus ID | 51573 |
UniProt ID | Q9NZC3 |
Refseq Size | 2960 |
Cytogenetics | 16p12.3 |
Refseq ORF | 993 |
Synonyms | 363E6.2; MIR16 |
Summary | Has glycerophosphoinositol phosphodiesterase activity. Hydrolyzes lysoglycerophospholipids to produce lysophosphatidic acid (LPA) and the corresponding amines. Has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Glycerophospholipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402574 | GDE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402574 | Transient overexpression lysate of glycerophosphodiester phosphodiesterase 1 (GDE1) |
CNY 3080.00 |
|
PH304923 | GDE1 MS Standard C13 and N15-labeled recombinant protein (NP_057725) |
CNY 19520.00 |