AMID (AIFM2) (NM_032797) Human Recombinant Protein
CAT#: TP304934
Recombinant protein of human apoptosis-inducing factor, mitochondrion-associated, 2 (AIFM2), nuclear gene encoding mitochondrial protein, 20 µg
View other "AMID" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204934 protein sequence
Red=Cloning site Green=Tags(s) MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYS VTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQ RSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVS NLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNV YAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLM VRLTKSRDLFVSTSWKTMRQSPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116186 |
| Locus ID | 84883 |
| UniProt ID | Q9BRQ8 |
| Refseq Size | 3253 |
| Cytogenetics | 10q22.1 |
| Refseq ORF | 1119 |
| Synonyms | AMID; FSP1; PRG3 |
| Summary | This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403212 | AIFM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403212 | Transient overexpression lysate of apoptosis-inducing factor, mitochondrion-associated, 2 (AIFM2), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH304934 | AIFM2 MS Standard C13 and N15-labeled recombinant protein (NP_116186) |
CNY 19520.00 |
