DPY30 (NM_032574) Human Recombinant Protein
CAT#: TP304981
Recombinant protein of human dpy-30 homolog (C. elegans) (DPY30), 20 µg
View other "DPY30" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204981 protein sequence
Red=Cloning site Green=Tags(s) MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLA VLAKERPPNPIEFLASYLLKNKAQFEDRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115963 |
Locus ID | 84661 |
UniProt ID | Q9C005 |
Refseq Size | 800 |
Cytogenetics | 2p22.3 |
Refseq ORF | 297 |
Synonyms | Cps25; HDPY-30; Saf19 |
Summary | This gene encodes an integral core subunit of the SET1/MLL family of H3K4 methyltransferases. The encoded protein directly controls cell cycle regulators and plays an important role in the proliferation and differentiation of human hematopoietic progenitor cells. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410030 | DPY30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410030 | Transient overexpression lysate of dpy-30 homolog (C. elegans) (DPY30) |
CNY 3080.00 |
|
PH304981 | DPY30 MS Standard C13 and N15-labeled recombinant protein (NP_115963) |
CNY 19520.00 |