UBE2W (NM_018299) Human Recombinant Protein
CAT#: TP304985
Recombinant protein of human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2, 20 µg
View other "UBE2W" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204985 protein sequence
Red=Cloning site Green=Tags(s) MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPK KTKWWYHDDTC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_060769 |
| Locus ID | 55284 |
| UniProt ID | Q96B02 |
| Refseq Size | 8426 |
| Cytogenetics | 8q21.11 |
| Refseq ORF | 453 |
| Synonyms | UBC-16; UBC16 |
| Summary | This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
| Protein Families | Transcription Factors |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402664 | UBE2W HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424359 | UBE2W HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402664 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 2 |
CNY 3080.00 |
|
| LY424359 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 1 |
CNY 3080.00 |
|
| PH304985 | UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_060769) |
CNY 19520.00 |
|
| PH321130 | UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_001001481) |
CNY 19520.00 |
|
| TP321130 | Recombinant protein of human ubiquitin-conjugating enzyme E2W (putative) (UBE2W), transcript variant 1, 20 µg |
CNY 2900.00 |
