C9orf78 (NM_016520) Human Recombinant Protein
CAT#: TP304997
Recombinant protein of human chromosome 9 open reading frame 78 (C9orf78), 20 µg
View other "C9orf78" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204997 protein sequence
Red=Cloning site Green=Tags(s) MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQ MKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEHEEQKVKSK NAEDCLYELPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQSKKKDSET SFVPTNMAVNYVQHNRFYHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKATDDYHYE KFKKMNRRY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057604 |
| Locus ID | 51759 |
| UniProt ID | Q9NZ63 |
| Refseq Size | 1835 |
| Cytogenetics | 9q34.11 |
| Refseq ORF | 867 |
| Synonyms | bA409K20.3; CSU2; HCA59; HSPC220 |
| Summary | Involved in the regulation of telomeric heterochromatin assembly and control of telomere length.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413954 | C9orf78 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413954 | Transient overexpression lysate of chromosome 9 open reading frame 78 (C9orf78) |
CNY 3080.00 |
|
| PH304997 | C9orf78 MS Standard C13 and N15-labeled recombinant protein (NP_057604) |
CNY 19520.00 |
|
| TP710188 | Purified recombinant protein of Human chromosome 9 open reading frame 78 (C9orf78), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
其它C9orf78产品

