AASDHPPT (NM_015423) Human Recombinant Protein
CAT#: TP305091
Recombinant protein of human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 20 µg
View other "AASDHPPT" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205091 protein sequence
Red=Cloning site Green=Tags(s) MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKL VAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGS IPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIG QVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSS AVPMTPEDPSFWDCFCFTEEIPIRNGTKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056238 |
| Locus ID | 60496 |
| UniProt ID | Q9NRN7 |
| Refseq Size | 2880 |
| Cytogenetics | 11q22.3 |
| Refseq ORF | 927 |
| Synonyms | AASD-PPT; ACPS; CGI-80; LYS2; LYS5 |
| Summary | The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Lysine biosynthesis, Lysine degradation, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414583 | AASDHPPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414583 | Transient overexpression lysate of aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT) |
CNY 3080.00 |
|
| PH305091 | AASDHPPT MS Standard C13 and N15-labeled recombinant protein (NP_056238) |
CNY 19520.00 |
其它AASDHPPT产品
