MVB12B (NM_001011703) Human Recombinant Protein
CAT#: TP305093
Recombinant protein of human family with sequence similarity 125, member B (FAM125B), transcript variant 2, 20 µg
View other "MVB12B" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205093 protein sequence
Red=Cloning site Green=Tags(s) MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVA QTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVA FRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSS AASTPAPNLPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001011703 |
| Locus ID | 89853 |
| UniProt ID | Q9H7P6 |
| Refseq Size | 2705 |
| Cytogenetics | 9q33.3 |
| Refseq ORF | 663 |
| Synonyms | C9orf28; FAM125B |
| Summary | The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409511 | MVB12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423295 | MVB12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409511 | Transient overexpression lysate of family with sequence similarity 125, member B (FAM125B), transcript variant 1 |
CNY 3080.00 |
|
| LY423295 | Transient overexpression lysate of family with sequence similarity 125, member B (FAM125B), transcript variant 2 |
CNY 3080.00 |
|
| PH305093 | FAM125B MS Standard C13 and N15-labeled recombinant protein (NP_001011703) |
CNY 19520.00 |
