SEPTIN7 (NM_001788) Human Recombinant Protein
CAT#: TP305163
Recombinant protein of human septin 7 (SEPT7), transcript variant 1, 20 µg
View other "SEPTIN7" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205163 protein sequence
Red=Cloning site Green=Tags(s) MAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKT VQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQC CLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDD EEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDV TNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQ KLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001779 |
Locus ID | 989 |
UniProt ID | Q16181 |
Refseq Size | 4380 |
Cytogenetics | 7p14.2 |
Refseq ORF | 1251 |
Synonyms | CDC3; CDC10; NBLA02942; SEPT7; SEPT7A |
Summary | This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. This human protein functions in gliomagenesis and in the suppression of glioma cell growth, and it is required for the association of centromere-associated protein E with the kinetochore. Alternative splicing results in multiple transcript variants. Several related pseudogenes have been identified on chromosomes 5, 7, 9, 10, 11, 14, 17 and 19. [provided by RefSeq, Jul 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419745 | 42254 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY419745 | Transient overexpression lysate of septin 7 (SEPT7), transcript variant 1 |
CNY 4840.00 |
|
PH305163 | SEPT7 MS Standard C13 and N15-labeled recombinant protein (NP_001779) |
CNY 19520.00 |
|
TP761518 | Purified recombinant protein of Human septin 7 (SEPT7), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它SEPTIN7产品