UNC50 (NM_014044) Human Recombinant Protein
CAT#: TP305276
Purified recombinant protein of Homo sapiens unc-50 homolog (C. elegans) (UNC50), 20 µg
View other "UNC50" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205276 protein sequence
Red=Cloning site Green=Tags(s) MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKY LVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTF LGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054763 |
| Locus ID | 25972 |
| UniProt ID | Q53HI1 |
| Refseq Size | 1167 |
| Cytogenetics | 2q11.2 |
| Refseq ORF | 777 |
| Synonyms | GMH1; HSD23; PDLs22; UNCL; URP |
| Summary | May be involved in cell surface expression of neuronal nicotinic receptors. Binds RNA (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402272 | UNC50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402272 | Transient overexpression lysate of unc-50 homolog (C. elegans) (UNC50) |
CNY 3080.00 |
|
| PH305276 | UNC50 MS Standard C13 and N15-labeled recombinant protein (NP_054763) |
CNY 14250.00 |
