PCTAIRE2 (CDK17) (NM_002595) Human Recombinant Protein
CAT#: TP305318
Recombinant protein of human PCTAIRE protein kinase 2 (PCTK2), 20 µg
View other "PCTAIRE2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 3340.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205318 protein sequence
Red=Cloning site Green=Tags(s) MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPL RRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMED LNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGR SKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDD CGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVV TLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNE EFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIF SLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002586 |
| Locus ID | 5128 |
| UniProt ID | Q00537 |
| Refseq Size | 4194 |
| Cytogenetics | 12q23.1 |
| Refseq ORF | 1569 |
| Synonyms | PCTAIRE2; PCTK2 |
| Summary | The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It has similarity to a rat protein that is thought to play a role in terminally differentiated neurons. Alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400928 | CDK17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433226 | CDK17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400928 | Transient overexpression lysate of cyclin-dependent kinase 17 (CDK17), transcript variant 1 |
CNY 3080.00 |
|
| LY433226 | Transient overexpression lysate of cyclin-dependent kinase 17 (CDK17), transcript variant 2 |
CNY 3080.00 |
|
| PH305318 | CDK17 MS Standard C13 and N15-labeled recombinant protein (NP_002586) |
CNY 19520.00 |
其它PCTAIRE2产品
