DAZL (NM_001351) Human Recombinant Protein
CAT#: TP305328
Recombinant protein of human deleted in azoospermia-like (DAZL), 20 µg
View other "DAZL" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205328 representing NM_001351
Red=Cloning site Green=Tags(s) MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK IITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQ NVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYS AVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDK RVHHFRRSRAMLKSV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001342 |
Locus ID | 1618 |
UniProt ID | Q92904 |
Refseq Size | 3056 |
Cytogenetics | 3p24.3 |
Refseq ORF | 885 |
Synonyms | DAZH; DAZL1; DAZLA; SPGYLA |
Summary | The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400541 | DAZL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434157 | DAZL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400541 | Transient overexpression lysate of deleted in azoospermia-like (DAZL) |
CNY 3080.00 |
|
LY434157 | Transient overexpression lysate of deleted in azoospermia-like (DAZL), transcript variant 1 |
CNY 3080.00 |
|
PH305328 | DAZL MS Standard C13 and N15-labeled recombinant protein (NP_001342) |
CNY 19520.00 |