EBAG9 (NM_004215) Human Recombinant Protein
CAT＃: TP305364
Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1, 20 µg
View other "EBAG9" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205364 protein sequence
Red=Cloning site Green=Tags(s) MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV KLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004206 |
| Locus ID | 9166 |
| UniProt ID | O00559 |
| Refseq Size | 2495 |
| Cytogenetics | 8q23.2 |
| Refseq ORF | 639 |
| Synonyms | EB9; PDAF |
| Summary | This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405069 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418143 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430709 | EBAG9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405069 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
CNY 3080.00 |
|
| LY418143 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1 |
CNY 3080.00 |
|
| LY430709 | Transient overexpression lysate of estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2 |
CNY 3080.00 |
|
| PH305364 | EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_004206) |
CNY 19520.00 |
|
| PH315667 | EBAG9 MS Standard C13 and N15-labeled recombinant protein (NP_936056) |
CNY 19520.00 |
|
| TP315667 | Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 2, 20 µg |
CNY 2900.00 |
