Calponin (CNN1) (NM_001299) Human Recombinant Protein
CAT#: TP305370
Recombinant protein of human calponin 1, basic, smooth muscle (CNN1), 20 µg
View other "Calponin" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 3600.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205370 protein sequence
Red=Cloning site Green=Tags(s) MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE LGEPAHNHHAHNYYNSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001290 |
| Locus ID | 1264 |
| UniProt ID | P51911 |
| Refseq Size | 1599 |
| Cytogenetics | 19p13.2 |
| Refseq ORF | 891 |
| Synonyms | HEL-S-14; Sm-Calp; SMCC |
| Summary | Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400519 | CNN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400519 | Transient overexpression lysate of calponin 1, basic, smooth muscle (CNN1) |
CNY 3080.00 |
|
| PH305370 | CNN1 MS Standard C13 and N15-labeled recombinant protein (NP_001290) |
CNY 19520.00 |
|
| TP762396 | Purified recombinant protein of Human calponin 1, basic, smooth muscle (CNN1), Leu67-Gly257, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
其它Calponin产品
