TSSK1 (TSSK1B) (NM_032028) Human Recombinant Protein
CAT#: TP305395
Recombinant protein of human testis-specific serine kinase 1B (TSSK1B), 20 µg
View other "TSSK1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205395 protein sequence
Red=Cloning site Green=Tags(s) MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST METEEGPPQQPPETRAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | TSSK1B activity verified in a biochemical assay: TSSK1B (testis-specific serine kinase 1B) (TP305395) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. TSSK1B is a serine/threonine kinase that is highly expressed in testis and may be involved in a signaling pathway during male germ cell development or mature sperm function. Varying concentrations of TSSK1B were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Reference Data | |
RefSeq | NP_114417 |
Locus ID | 83942 |
UniProt ID | Q9BXA7 |
Refseq Size | 2478 |
Cytogenetics | 5q22.2 |
Refseq ORF | 1101 |
Synonyms | FKSG81; SPOGA4; STK22D; TSK1; TSSK1 |
Summary | TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403140 | TSSK1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403140 | Transient overexpression lysate of testis-specific serine kinase 1B (TSSK1B) |
CNY 3080.00 |
|
PH305395 | TSSK1B MS Standard C13 and N15-labeled recombinant protein (NP_114417) |
CNY 19520.00 |