DDI1 (NM_001001711) Human Recombinant Protein
CAT#: TP305403
Recombinant protein of human DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae) (DDI1), 20 µg
View other "DDI1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205403 protein sequence
Red=Cloning site Green=Tags(s) MLITVYCVRRDLSEVTFSLQVSPDFELRNFKVLCEAESRVPVEEIQIIHMERLLIEDHCSLGSYGLKDGD IVVLLQKDNVGPRAPGRAPNQPRVDFSGIAVPGTSSSRPQHPGQQQQRTPAAQRSQGLASGEKVAGLQGL GSPALIRSMLLSNPHDLSLLKERNPPLAEALLSGSLETFSQVLMEQQREKALREQERLRLYTADPLDREA QAKIEEEIRQQNIEENMNIAIEEAPESFGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMR LVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLV IGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKEH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001001711 |
Locus ID | 414301 |
UniProt ID | Q8WTU0 |
Refseq Size | 2615 |
Cytogenetics | 11q22.3 |
Refseq ORF | 1188 |
Summary | Probable aspartic protease (Probable). Seems to act as a proteasomal shuttle which links the proteasome and replication fork proteins like RTF2 (Probable). Required, with DDI2, for cellular survival following replication stress. Together or redudantly with DDI2, removes RTF2 from stalled forks to allow cell cycle progression after replication stress and maintains genome integrity (PubMed:29290612).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424216 | DDI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424216 | Transient overexpression lysate of DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae) (DDI1) |
CNY 3080.00 |
|
PH305403 | DDI1 MS Standard C13 and N15-labeled recombinant protein (NP_001001711) |
CNY 19520.00 |