SLC25A42 (NM_178526) Human Recombinant Protein
CAT#: TP305444
Recombinant protein of human solute carrier family 25, member 42 (SLC25A42), 20 µg
View other "SLC25A42" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205444 protein sequence
Red=Cloning site Green=Tags(s) MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSA KEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGAL AGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYET LKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGA VRGLYKGLSMNWVKGPIAVGISFTTFDLMQIMLRHLQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848621 |
Locus ID | 284439 |
UniProt ID | Q86VD7 |
Refseq Size | 3279 |
Cytogenetics | 19p13.11 |
Refseq ORF | 954 |
Synonyms | MECREN |
Summary | This gene encodes a solute carrier family 25 protein. Solute carrier family 25 proteins are localized to mitochondria and play critical roles in the transport of molecules across the inner mitochondrial membrane. The encoded protein is a mitochondrial transporter for coenzyme A (CoA) and adenosine 3',5'-diphosphate. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405906 | SLC25A42 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405906 | Transient overexpression lysate of solute carrier family 25, member 42 (SLC25A42) |
CNY 3080.00 |
|
PH305444 | SLC25A42 MS Standard C13 and N15-labeled recombinant protein (NP_848621) |
CNY 19520.00 |
其它SLC25A42产品