C1orf19 (TSEN15) (NM_052965) Human Recombinant Protein
CAT#: TP305519
Recombinant protein of human tRNA splicing endonuclease 15 homolog (S. cerevisiae) (TSEN15), transcript variant 1, 20 µg
View other "C1orf19" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205519 protein sequence
Red=Cloning site Green=Tags(s) MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT LAIVESDSTIVYYKLTDGFMLPDPQNISLRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443197 |
Locus ID | 116461 |
UniProt ID | Q8WW01 |
Refseq Size | 1998 |
Cytogenetics | 1q25.3 |
Refseq ORF | 513 |
Synonyms | C1orf19; PCH2F; sen15 |
Summary | This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by RefSeq, Jul 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409366 | TSEN15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409366 | Transient overexpression lysate of tRNA splicing endonuclease 15 homolog (S. cerevisiae) (TSEN15), transcript variant 1 |
CNY 3080.00 |
|
PH305519 | TSEN15 MS Standard C13 and N15-labeled recombinant protein (NP_443197) |
CNY 19520.00 |
其它C1orf19产品