ADO (NM_032804) Human Recombinant Protein
CAT#: TP305583
Recombinant protein of human 2-aminoethanethiol (cysteamine) dioxygenase (ADO), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205583 protein sequence
Red=Cloning site Green=Tags(s) MPRDNMASLIQRIARQACLTFRGSWGGRGASDRDAASGAEAPMQPGFPENLSKLKSLLTQLRAEDLNIAP RKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGG GQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAP PYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116193 |
| Locus ID | 84890 |
| UniProt ID | Q96SZ5 |
| Refseq Size | 3739 |
| Cytogenetics | 10q21.3 |
| Refseq ORF | 810 |
| Synonyms | C10orf22 |
| Summary | Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine (Dominy et al., 2007 [PubMed 17581819]).[supplied by OMIM, Mar 2008] |
| Protein Pathways | Metabolic pathways, Taurine and hypotaurine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409931 | ADO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409931 | Transient overexpression lysate of 2-aminoethanethiol (cysteamine) dioxygenase (ADO) |
CNY 3080.00 |
|
| PH305583 | ADO MS Standard C13 and N15-labeled recombinant protein (NP_116193) |
CNY 19520.00 |
