TIMM10 (NM_012456) Human Recombinant Protein
CAT#: TP305668
Recombinant protein of human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein, 20 µg
View other "TIMM10" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205668 protein sequence
Red=Cloning site Green=Tags(s) MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLT ELSMQDEELMKRVQQSSGPA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036588 |
Locus ID | 26519 |
UniProt ID | P62072 |
Refseq Size | 684 |
Cytogenetics | 11q12.1 |
Refseq ORF | 270 |
Synonyms | TIM10; TIM10A; TIMM10A |
Summary | The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins. [provided by RefSeq, Nov 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415747 | TIMM10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415747 | Transient overexpression lysate of translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
PH305668 | TIMM10 MS Standard C13 and N15-labeled recombinant protein (NP_036588) |
CNY 19520.00 |