Moesin (MSN) (NM_002444) Human Recombinant Protein
CAT#: TP305674
Recombinant protein of human moesin (MSN), 20 µg
View other "Moesin" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205674 protein sequence
Red=Cloning site Green=Tags(s) MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDV RKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKE VHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKN KKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMER LKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEA SADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR QIRQGNTKQRIDEFESM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 67.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002435 |
| Locus ID | 4478 |
| UniProt ID | P26038 |
| Refseq Size | 3981 |
| Cytogenetics | Xq12 |
| Refseq ORF | 1731 |
| Synonyms | HEL70; IMD50 |
| Summary | Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Leukocyte transendothelial migration, Regulation of actin cytoskeleton |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
MAP4K4 regulates integrin-FERM binding to control endothelial cell motility.
,null,
Nature
,PubMed ID 25799996
[MSN]
|
|
Are ERM (ezrin/radixin/moesin) proteins targets for autoantibodies in demyelinating neuropathies?
,Miyaji, K;Shahrizaila, N;Umapathi, T;Chan, YC;Hirata, K;Yuki, N;,
Hum. Immunol.
,PubMed ID 25286001
[MSN]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419318 | MSN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419318 | Transient overexpression lysate of moesin (MSN) |
CNY 3080.00 |
|
| PH305674 | MSN MS Standard C13 and N15-labeled recombinant protein (NP_002435) |
CNY 19520.00 |
|
| TP710366 | Purified recombinant protein of human moesin (MSN), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
