Troponin I fast skeletal muscle (TNNI2) (NM_003282) Human Recombinant Protein
CAT#: TP305676
Recombinant protein of human troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 1, 20 µg
View other "Troponin I fast skeletal muscle" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205676 protein sequence
Red=Cloning site Green=Tags(s) MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHA KIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRAN LKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003273 |
Locus ID | 7136 |
UniProt ID | P48788 |
Refseq Size | 738 |
Cytogenetics | 11p15.5 |
Refseq ORF | 546 |
Synonyms | AMCD2B; DA2B; DA2B1; FSSV; fsTnI |
Summary | This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Elevation of fast but not slow troponin I in the circulation of patients with Becker and Duchenne muscular dystrophy, et al. Elevation of fast but not slow troponin I in the circulation of patients with Becker and Duchenne muscular dystrophy
,null,
Muscle & Nerve
,PubMed ID 33683712
[TNNI2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418789 | TNNI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429022 | TNNI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429025 | TNNI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418789 | Transient overexpression lysate of troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 1 |
CNY 3080.00 |
|
LY429022 | Transient overexpression lysate of troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 2 |
CNY 3080.00 |
|
LY429025 | Transient overexpression lysate of troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 3 |
CNY 3080.00 |
|
PH305676 | TNNI2 MS Standard C13 and N15-labeled recombinant protein (NP_003273) |
CNY 19520.00 |
|
PH327419 | TNNI2 MS Standard C13 and N15-labeled recombinant protein (NP_001139301) |
CNY 19520.00 |
|
TP327419 | Recombinant protein of human troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP701243 | Purified recombinant protein of Human troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 1, full length, with N-terminal DDK tag, expressed in HEK293 cells, 20ug |
CNY 2900.00 |
其它Troponin I fast skeletal muscle产品