RRM2 (NM_001034) Human Recombinant Protein
CAT#: TP305718
Recombinant protein of human ribonucleotide reductase M2 polypeptide (RRM2), 20 µg
View other "RRM2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205718 representing NM_001034
Red=Cloning site Green=Tags(s) MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE PLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGI VNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWA LRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHL VHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM ENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Binding assay (PMID: 29765556) |
Reference Data | |
RefSeq | NP_001025 |
Locus ID | 6241 |
UniProt ID | P31350 |
Refseq Size | 2500 |
Cytogenetics | 2p25.1 |
Refseq ORF | 1167 |
Synonyms | C2orf48; R2; RR2; RR2M |
Summary | This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Glutathione metabolism, Metabolic pathways, p53 signaling pathway, Purine metabolism, Pyrimidine metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Antibody-assisted target identification reveals afatinib, an EGFR covalent inhibitor, down-regulating ribonucleotide reductase
,Yu, CH;Chou, CC;Tu, HF;Huang, WC;Ho, YY;Khoo, KH;Lee, MS;Chang, GD;,
Oncotarget
,PubMed ID 29765556
[RRM2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421950 | RRM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431390 | RRM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421950 | Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 2 |
CNY 3080.00 |
|
LY431390 | Transient overexpression lysate of ribonucleotide reductase M2 (RRM2), transcript variant 1 |
CNY 3080.00 |
|
PH305718 | RRM2 MS Standard C13 and N15-labeled recombinant protein (NP_001025) |
CNY 19520.00 |