FAAP24 (NM_152266) Human Recombinant Protein
CAT#: TP305872
Recombinant protein of human chromosome 19 open reading frame 40 (C19orf40), 20 µg
View other "FAAP24" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205872 representing NM_152266
Red=Cloning site Green=Tags(s) MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGN GYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEP SKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAF FTQPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689479 |
Locus ID | 91442 |
UniProt ID | Q9BTP7 |
Refseq Size | 1130 |
Cytogenetics | 19q13.11 |
Refseq ORF | 645 |
Synonyms | C19orf40 |
Summary | FAAP24 is a component of the Fanconi anemia (FA) core complex (see MIM 227650), which plays a crucial role in DNA damage response (Ciccia et al., 2007 [PubMed 17289582]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407688 | C19orf40 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407688 | Transient overexpression lysate of chromosome 19 open reading frame 40 (C19orf40) |
CNY 3080.00 |
|
PH305872 | C19orf40 MS Standard C13 and N15-labeled recombinant protein (NP_689479) |
CNY 19520.00 |